SCOP 1.67: Domain d1mqlh_: 1mql H:

Lineage for d1mqlh_ (1mql H:)

1. Root: SCOP 1.67

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries)

8. Domain d1mqlh_: 1mql H: [91405]
   Other proteins in same PDB: d1mqla_, d1mqld_, d1mqlg_
   complexed with man, nag

Details for d1mqlh_

PDB Entry: 1mql, 2.9 Å

PDB Description: bha of ukr/63

SCOP Domain Sequences for d1mqlh_:

Sequence; same for both SEQRES and ATOM records:

>d1mqlh_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfq

Timeline for d1mqlh_:

• d1mqlh_ is new in SCOP 1.67
  
• d1mqlh_ appears in SCOP 1.69
  
• d1mqlh_ appears in the current release, SCOPe 2.08