Lineage for d1mqia_ (1mqi A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 403440Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 403441Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 403442Family c.94.1.1: Phosphate binding protein-like [53851] (26 proteins)
  6. 403555Protein Glutamate receptor ligand binding core [53881] (2 species)
  7. 403556Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (43 PDB entries)
  8. 403557Domain d1mqia_: 1mqi A: [91398]
    complexed with fwd

Details for d1mqia_

PDB Entry: 1mqi (more details), 1.35 Å

PDB Description: crystal structure of the glur2 ligand binding core (s1s2j) in complex with fluoro-willardiine at 1.35 angstroms resolution

SCOP Domain Sequences for d1mqia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgecg

SCOP Domain Coordinates for d1mqia_:

Click to download the PDB-style file with coordinates for d1mqia_.
(The format of our PDB-style files is described here.)

Timeline for d1mqia_: