Lineage for d1mqbb_ (1mqb B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419158Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 419159Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 419200Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 419454Protein epha2 receptor tyrosine kinase [103294] (1 species)
    PTK group; Eph/Elk/Eck subfamily; membrane spanning protein tyrosine kinase
  7. 419455Species Human (Homo sapiens) [TaxId:9606] [103295] (1 PDB entry)
  8. 419457Domain d1mqbb_: 1mqb B: [91393]
    complexed with anp

Details for d1mqbb_

PDB Entry: 1mqb (more details), 2.3 Å

PDB Description: Crystal Structure of Ephrin A2 (ephA2) Receptor Protein Kinase

SCOP Domain Sequences for d1mqbb_:

Sequence, based on SEQRES records: (download)

>d1mqbb_ d.144.1.7 (B:) epha2 receptor tyrosine kinase {Human (Homo sapiens)}
lkftteihpscvtrqkvigagefgevykgmlktssgkkevpvaiktlkagytekqrvdfl
geagimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlr
giaagmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvleddpeatyttsggkipi
rwtapeaisyrkftsasdvwsfgivmwevmtygerpywelsnhevmkaindgfrlptpmd
cpsaiyqlmmqcwqqerarrpkfadivsildklirapdslkt

Sequence, based on observed residues (ATOM records): (download)

>d1mqbb_ d.144.1.7 (B:) epha2 receptor tyrosine kinase {Human (Homo sapiens)}
lkftteihpscvtrqkvigagefgevykgmlktkevpvaiktlkagytekqrvdflgeag
imgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrgiaa
gmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvlkipirwtapeaisyrkftsas
dvwsfgivmwevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqer
arrpkfadivsildklirapdslkt

SCOP Domain Coordinates for d1mqbb_:

Click to download the PDB-style file with coordinates for d1mqbb_.
(The format of our PDB-style files is described here.)

Timeline for d1mqbb_: