Lineage for d1mqba_ (1mqb A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543622Protein epha2 receptor tyrosine kinase [103294] (1 species)
    PTK group; Eph/Elk/Eck subfamily; membrane spanning protein tyrosine kinase
  7. 2543623Species Human (Homo sapiens) [TaxId:9606] [103295] (1 PDB entry)
  8. 2543624Domain d1mqba_: 1mqb A: [91392]
    complexed with anp

Details for d1mqba_

PDB Entry: 1mqb (more details), 2.3 Å

PDB Description: Crystal Structure of Ephrin A2 (ephA2) Receptor Protein Kinase
PDB Compounds: (A:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d1mqba_:

Sequence, based on SEQRES records: (download)

>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
tteihpscvtrqkvigagefgevykgmlktssgkkevpvaiktlkagytekqrvdflgea
gimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrgia
agmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvleddpeatyttsggkipirwt
apeaisyrkftsasdvwsfgivmwevmtygerpywelsnhevmkaindgfrlptpmdcps
aiyqlmmqcwqqerarrpkfadivsildklirapdslktladf

Sequence, based on observed residues (ATOM records): (download)

>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
tteihpscvtrqkvigagefgevykgmlktkkevpvaiktlkagytekqrvdflgeagim
gqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrgiaagm
kylanmnyvhrdlaarnilvnsnlvckvsdfglkipirwtapeaisyrkftsasdvwsfg
ivmwevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqerarrpkf
adivsildklirapdslktladf

SCOPe Domain Coordinates for d1mqba_:

Click to download the PDB-style file with coordinates for d1mqba_.
(The format of our PDB-style files is described here.)

Timeline for d1mqba_: