Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.1: Cytidine deaminase [53928] (4 proteins) strand 5 is antiparallel to strand 4 |
Protein mono-domain cytidine deaminase [75327] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [102711] (1 PDB entry) |
Domain d1mq0b_: 1mq0 B: [91390] complexed with brd, zn |
PDB Entry: 1mq0 (more details), 2.4 Å
SCOPe Domain Sequences for d1mq0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mq0b_ c.97.1.1 (B:) mono-domain cytidine deaminase {Human (Homo sapiens) [TaxId: 9606]} ecvqqllvcsqeakqsaycpyshfpvgaalltqegrifkgcnienacyplgicaertaiq kavsegykdfraiaiasdmqddfispcgacrqvmrefgtnwpvymtkpdgtyivmtvqel lpssfgpedl
Timeline for d1mq0b_: