Lineage for d1mq0b_ (1mq0 B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847589Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 847590Superfamily c.97.1: Cytidine deaminase-like [53927] (5 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 847591Family c.97.1.1: Cytidine deaminase [53928] (3 proteins)
    strand 5 is antiparallel to strand 4
  6. 847608Protein mono-domain cytidine deaminase [75327] (5 species)
  7. 847628Species Human (Homo sapiens) [TaxId:9606] [102711] (1 PDB entry)
  8. 847630Domain d1mq0b_: 1mq0 B: [91390]
    complexed with brd, zn; mutant

Details for d1mq0b_

PDB Entry: 1mq0 (more details), 2.4 Å

PDB Description: crystal structure of human cytidine deaminase
PDB Compounds: (B:) Cytidine deaminase

SCOP Domain Sequences for d1mq0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mq0b_ c.97.1.1 (B:) mono-domain cytidine deaminase {Human (Homo sapiens) [TaxId: 9606]}
ecvqqllvcsqeakqsaycpyshfpvgaalltqegrifkgcnienacyplgicaertaiq
kavsegykdfraiaiasdmqddfispcgacrqvmrefgtnwpvymtkpdgtyivmtvqel
lpssfgpedl

SCOP Domain Coordinates for d1mq0b_:

Click to download the PDB-style file with coordinates for d1mq0b_.
(The format of our PDB-style files is described here.)

Timeline for d1mq0b_: