Lineage for d1mq0b_ (1mq0 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 594389Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 594390Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 594391Family c.97.1.1: Cytidine deaminase [53928] (2 proteins)
    strand 5 is antiparallel to strand 4
  6. 594392Protein mono-domain cytidine deaminase [75327] (3 species)
  7. 594409Species Human (Homo sapiens) [TaxId:9606] [102711] (1 PDB entry)
  8. 594411Domain d1mq0b_: 1mq0 B: [91390]
    complexed with brd, zn; mutant

Details for d1mq0b_

PDB Entry: 1mq0 (more details), 2.4 Å

PDB Description: crystal structure of human cytidine deaminase

SCOP Domain Sequences for d1mq0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mq0b_ c.97.1.1 (B:) mono-domain cytidine deaminase {Human (Homo sapiens)}
ecvqqllvcsqeakqsaycpyshfpvgaalltqegrifkgcnienacyplgicaertaiq
kavsegykdfraiaiasdmqddfispcgacrqvmrefgtnwpvymtkpdgtyivmtvqel
lpssfgpedl

SCOP Domain Coordinates for d1mq0b_:

Click to download the PDB-style file with coordinates for d1mq0b_.
(The format of our PDB-style files is described here.)

Timeline for d1mq0b_: