SCOPe 2.05: Domain d1mq0a_: 1mq0 A:

Lineage for d1mq0a_ (1mq0 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
   strand 5 is antiparallel to strand 4

6. Protein mono-domain cytidine deaminase [75327] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102711] (1 PDB entry)

8. Domain d1mq0a_: 1mq0 A: [91389]
   complexed with brd, zn

Details for d1mq0a_

PDB Entry: 1mq0, 2.4 Å

PDB Description: crystal structure of human cytidine deaminase

PDB Compounds: (A:) Cytidine deaminase

SCOPe Domain Sequences for d1mq0a_:

Sequence; same for both SEQRES and ATOM records:

>d1mq0a_ c.97.1.1 (A:) mono-domain cytidine deaminase {Human (Homo sapiens) [TaxId: 9606]}
ecvqqllvcsqeakqsaycpyshfpvgaalltqegrifkgcnienacyplgicaertaiq
kavsegykdfraiaiasdmqddfispcgacrqvmrefgtnwpvymtkpdgtyivmtvqel
lpssfgpedl

Timeline for d1mq0a_:

• d1mq0a_ first appeared in SCOP 1.67
  
• d1mq0a_ appears in SCOPe 2.04
  
• d1mq0a_ appears in SCOPe 2.06
  
• d1mq0a_ appears in the current release, SCOPe 2.08