Lineage for d1mq0a_ (1mq0 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404230Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest
  4. 404231Superfamily c.97.1: Cytidine deaminase-like [53927] (2 families) (S)
  5. 404232Family c.97.1.1: Cytidine deaminase [53928] (2 proteins)
  6. 404233Protein mono-domain cytidine deaminase [75327] (2 species)
  7. 404237Species Human (Homo sapiens) [TaxId:9606] [102711] (1 PDB entry)
  8. 404238Domain d1mq0a_: 1mq0 A: [91389]

Details for d1mq0a_

PDB Entry: 1mq0 (more details), 2.4 Å

PDB Description: crystal structure of human cytidine deaminase

SCOP Domain Sequences for d1mq0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mq0a_ c.97.1.1 (A:) mono-domain cytidine deaminase {Human (Homo sapiens)}
ecvqqllvcsqeakqsaycpyshfpvgaalltqegrifkgcnienacyplgicaertaiq
kavsegykdfraiaiasdmqddfispcgacrqvmrefgtnwpvymtkpdgtyivmtvqel
lpssfgpedl

SCOP Domain Coordinates for d1mq0a_:

Click to download the PDB-style file with coordinates for d1mq0a_.
(The format of our PDB-style files is described here.)

Timeline for d1mq0a_: