SCOPe 2.07: Domain d1mp9b1: 1mp9 B:3-96

Lineage for d1mp9b1 (1mp9 B:3-96)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats
   automatically mapped to Pfam PF00352

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Sulfolobus acidocaldarius [TaxId:2285] [103238] (1 PDB entry)

8. Domain d1mp9b1: 1mp9 B:3-96 [91387]

Details for d1mp9b1

PDB Entry: 1mp9, 2 Å

PDB Description: tbp from a mesothermophilic archaeon, sulfolobus acidocaldarius

PDB Compounds: (B:) tata-binding protein

SCOPe Domain Sequences for d1mp9b1:

Sequence; same for both SEQRES and ATOM records:

>d1mp9b1 d.129.1.1 (B:3-96) TATA-box binding protein (TBP), C-terminal domain {Sulfolobus acidocaldarius [TaxId: 2285]}
ipdeipykavvnienivatvtldqtldlyamersvpnveydpdqfpglifrlespkitsl
ifksgkmvvtgakstdelikavkriiktlkkygm

Timeline for d1mp9b1:

• d1mp9b1 first appeared in SCOP 1.67
  
• d1mp9b1 appears in SCOPe 2.06
  
• d1mp9b1 appears in the current release, SCOPe 2.08