Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats automatically mapped to Pfam PF00352 |
Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
Species Sulfolobus acidocaldarius [TaxId:2285] [103238] (1 PDB entry) |
Domain d1mp9b1: 1mp9 B:3-96 [91387] |
PDB Entry: 1mp9 (more details), 2 Å
SCOPe Domain Sequences for d1mp9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mp9b1 d.129.1.1 (B:3-96) TATA-box binding protein (TBP), C-terminal domain {Sulfolobus acidocaldarius [TaxId: 2285]} ipdeipykavvnienivatvtldqtldlyamersvpnveydpdqfpglifrlespkitsl ifksgkmvvtgakstdelikavkriiktlkkygm
Timeline for d1mp9b1: