Lineage for d1mp9a2 (1mp9 A:97-197)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510905Fold d.129: TBP-like [55944] (8 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 510906Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 510907Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
  6. 510908Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 510969Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [103238] (1 PDB entry)
  8. 510971Domain d1mp9a2: 1mp9 A:97-197 [91386]

Details for d1mp9a2

PDB Entry: 1mp9 (more details), 2 Å

PDB Description: tbp from a mesothermophilic archaeon, sulfolobus acidocaldarius

SCOP Domain Sequences for d1mp9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mp9a2 d.129.1.1 (A:97-197) TATA-box binding protein (TBP), C-terminal domain {Archaeon Sulfolobus acidocaldarius}
qltgkpkiqiqnivasanlhvivnldkaafllennmyepeqfpgliyrmdeprvvllifs
sgkmvitgakredevhkavkkifdklveldcvkpveeeele

SCOP Domain Coordinates for d1mp9a2:

Click to download the PDB-style file with coordinates for d1mp9a2.
(The format of our PDB-style files is described here.)

Timeline for d1mp9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mp9a1