![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) ![]() |
![]() | Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats automatically mapped to Pfam PF00352 |
![]() | Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
![]() | Species Sulfolobus acidocaldarius [TaxId:2285] [103238] (1 PDB entry) |
![]() | Domain d1mp9a1: 1mp9 A:5-96 [91385] |
PDB Entry: 1mp9 (more details), 2 Å
SCOPe Domain Sequences for d1mp9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mp9a1 d.129.1.1 (A:5-96) TATA-box binding protein (TBP), C-terminal domain {Sulfolobus acidocaldarius [TaxId: 2285]} deipykavvnienivatvtldqtldlyamersvpnveydpdqfpglifrlespkitslif ksgkmvvtgakstdelikavkriiktlkkygm
Timeline for d1mp9a1: