Lineage for d1mp9a1 (1mp9 A:5-96)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975209Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2975210Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 2975211Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 2975265Species Sulfolobus acidocaldarius [TaxId:2285] [103238] (1 PDB entry)
  8. 2975266Domain d1mp9a1: 1mp9 A:5-96 [91385]

Details for d1mp9a1

PDB Entry: 1mp9 (more details), 2 Å

PDB Description: tbp from a mesothermophilic archaeon, sulfolobus acidocaldarius
PDB Compounds: (A:) tata-binding protein

SCOPe Domain Sequences for d1mp9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mp9a1 d.129.1.1 (A:5-96) TATA-box binding protein (TBP), C-terminal domain {Sulfolobus acidocaldarius [TaxId: 2285]}
deipykavvnienivatvtldqtldlyamersvpnveydpdqfpglifrlespkitslif
ksgkmvvtgakstdelikavkriiktlkkygm

SCOPe Domain Coordinates for d1mp9a1:

Click to download the PDB-style file with coordinates for d1mp9a1.
(The format of our PDB-style files is described here.)

Timeline for d1mp9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mp9a2