Lineage for d1mp1a1 (1mp1 A:27-134)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349223Fold a.188: PWI domain [101232] (1 superfamily)
    4 helices; up-and-down bundle; topological similarity to the bromodomain-like and SAM domain-like folds
  4. 2349224Superfamily a.188.1: PWI domain [101233] (1 family) (S)
  5. 2349225Family a.188.1.1: PWI domain [101234] (1 protein)
  6. 2349226Protein Ser/Arg-related nuclear matrix protein srm160 [101235] (1 species)
  7. 2349227Species Human (Homo sapiens) [TaxId:9606] [101236] (1 PDB entry)
  8. 2349228Domain d1mp1a1: 1mp1 A:27-134 [91382]
    Other proteins in same PDB: d1mp1a2

Details for d1mp1a1

PDB Entry: 1mp1 (more details)

PDB Description: solution structure of the pwi motif from srm160
PDB Compounds: (A:) Ser/Arg-related nuclear matrix protein

SCOPe Domain Sequences for d1mp1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mp1a1 a.188.1.1 (A:27-134) Ser/Arg-related nuclear matrix protein srm160 {Human (Homo sapiens) [TaxId: 9606]}
qlkfaeclekkvdmskvnlevikpwitkrvteilgfeddvviefifnqlevknpdskmmq
inltgflngknarefmgelwplllsaqeniagipsaflelkkeeikqr

SCOPe Domain Coordinates for d1mp1a1:

Click to download the PDB-style file with coordinates for d1mp1a1.
(The format of our PDB-style files is described here.)

Timeline for d1mp1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mp1a2