Class a: All alpha proteins [46456] (289 folds) |
Fold a.188: PWI domain [101232] (1 superfamily) 4 helices; up-and-down bundle; topological similarity to the bromodomain-like and SAM domain-like folds |
Superfamily a.188.1: PWI domain [101233] (1 family) |
Family a.188.1.1: PWI domain [101234] (1 protein) |
Protein Ser/Arg-related nuclear matrix protein srm160 [101235] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101236] (1 PDB entry) |
Domain d1mp1a1: 1mp1 A:27-134 [91382] Other proteins in same PDB: d1mp1a2 |
PDB Entry: 1mp1 (more details)
SCOPe Domain Sequences for d1mp1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mp1a1 a.188.1.1 (A:27-134) Ser/Arg-related nuclear matrix protein srm160 {Human (Homo sapiens) [TaxId: 9606]} qlkfaeclekkvdmskvnlevikpwitkrvteilgfeddvviefifnqlevknpdskmmq inltgflngknarefmgelwplllsaqeniagipsaflelkkeeikqr
Timeline for d1mp1a1: