Lineage for d1mp1a_ (1mp1 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362430Fold a.188: PWI domain [101232] (1 superfamily)
    4 helices; up-and-down bundle; topological similarity to the bromodomain-like and SAM domain-like folds
  4. 362431Superfamily a.188.1: PWI domain [101233] (1 family) (S)
  5. 362432Family a.188.1.1: PWI domain [101234] (1 protein)
  6. 362433Protein Ser/arg-related nuclear matrix protein srm160 [101235] (1 species)
  7. 362434Species Human (Homo sapiens) [TaxId:9606] [101236] (1 PDB entry)
  8. 362435Domain d1mp1a_: 1mp1 A: [91382]

Details for d1mp1a_

PDB Entry: 1mp1 (more details)

PDB Description: Solution structure of the PWI motif from SRm160

SCOP Domain Sequences for d1mp1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mp1a_ a.188.1.1 (A:) Ser/arg-related nuclear matrix protein srm160 {Human (Homo sapiens)}
shmqlkfaeclekkvdmskvnlevikpwitkrvteilgfeddvviefifnqlevknpdsk
mmqinltgflngknarefmgelwplllsaqeniagipsaflelkkeeikqr

SCOP Domain Coordinates for d1mp1a_:

Click to download the PDB-style file with coordinates for d1mp1a_.
(The format of our PDB-style files is described here.)

Timeline for d1mp1a_: