Lineage for d1moxc_ (1mox C:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258588Protein Transforming growth factor alpha [57217] (1 species)
  7. 2258589Species Human (Homo sapiens) [TaxId:9606] [57218] (7 PDB entries)
  8. 2258591Domain d1moxc_: 1mox C: [91380]
    Other proteins in same PDB: d1moxa1, d1moxa2, d1moxa3, d1moxa4, d1moxb1, d1moxb2, d1moxb3, d1moxb4
    complexed with EGF receptor
    complexed with cd, cl, nag, pt

Details for d1moxc_

PDB Entry: 1mox (more details), 2.5 Å

PDB Description: crystal structure of human epidermal growth factor receptor (residues 1-501) in complex with tgf-alpha
PDB Compounds: (C:) transforming growth factor alpha

SCOPe Domain Sequences for d1moxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]}
vshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla

SCOPe Domain Coordinates for d1moxc_:

Click to download the PDB-style file with coordinates for d1moxc_.
(The format of our PDB-style files is described here.)

Timeline for d1moxc_: