Lineage for d1moxc_ (1mox C:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 747705Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 748050Protein Transforming growth factor alpha [57217] (1 species)
  7. 748051Species Human (Homo sapiens) [TaxId:9606] [57218] (6 PDB entries)
  8. 748052Domain d1moxc_: 1mox C: [91380]
    Other proteins in same PDB: d1moxa1, d1moxa2, d1moxa3, d1moxa4, d1moxb1, d1moxb2, d1moxb3, d1moxb4

Details for d1moxc_

PDB Entry: 1mox (more details), 2.5 Å

PDB Description: crystal structure of human epidermal growth factor receptor (residues 1-501) in complex with tgf-alpha
PDB Compounds: (C:) transforming growth factor alpha

SCOP Domain Sequences for d1moxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]}
vshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla

SCOP Domain Coordinates for d1moxc_:

Click to download the PDB-style file with coordinates for d1moxc_.
(The format of our PDB-style files is described here.)

Timeline for d1moxc_: