Class g: Small proteins [56992] (92 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) |
Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins) |
Protein EGF receptor Cys-rich domains [82887] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82888] (6 PDB entries) |
Domain d1moxb3: 1mox B:163-311 [91378] Other proteins in same PDB: d1moxa1, d1moxa2, d1moxb1, d1moxb2, d1moxc_, d1moxd_ complexed with TGF-alpha complexed with cd, cl, nag, pt |
PDB Entry: 1mox (more details), 2.5 Å
SCOPe Domain Sequences for d1moxb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1moxb3 g.3.9.1 (B:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} cqkcdpscpngscwgageencqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpres dclvcrkfrdeatckdtcpplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgs cvracgadsyemeedgvrkckkcegpcrk
Timeline for d1moxb3: