SCOPe 2.05: Domain d1mo1c_: 1mo1 C:

Lineage for d1mo1c_ (1mo1 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (3 proteins)
   automatically mapped to Pfam PF00381

6. Protein Crh, catabolite repression HPr-like protein [69783] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [69784] (6 PDB entries)

8. Domain d1mo1c_: 1mo1 C: [91365]
   N-terminal strand-swapped dimer
   complexed with gol, so4

Details for d1mo1c_

PDB Entry: 1mo1, 1.8 Å

PDB Description: crystal structure at 1.8 angstroms of seleno methionyled crh, the bacillus subtilis catabolite repression containing protein crh reveals an unexpected swapping domain as an untertwinned dimer

PDB Compounds: (C:) HPr-like protein crh

SCOPe Domain Sequences for d1mo1c_:

Sequence; same for both SEQRES and ATOM records:

>d1mo1c_ d.94.1.1 (C:) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]}
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeevlq

Timeline for d1mo1c_:

• d1mo1c_ first appeared in SCOP 1.67
  
• d1mo1c_ appears in SCOPe 2.04
  
• d1mo1c_ is called d1mo1c1 in SCOPe 2.06
  
• d1mo1c_ appears in the current release, SCOPe 2.08, called d1mo1c1