Lineage for d1mo1a1 (1mo1 A:1-85)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531038Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2531039Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2531040Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2531041Protein Crh, catabolite repression HPr-like protein [69783] (1 species)
  7. 2531042Species Bacillus subtilis [TaxId:1423] [69784] (6 PDB entries)
  8. 2531043Domain d1mo1a1: 1mo1 A:1-85 [91363]
    Other proteins in same PDB: d1mo1a2, d1mo1b2, d1mo1c2, d1mo1d2
    N-terminal strand-swapped dimer
    complexed with gol, so4

Details for d1mo1a1

PDB Entry: 1mo1 (more details), 1.8 Å

PDB Description: crystal structure at 1.8 angstroms of seleno methionyled crh, the bacillus subtilis catabolite repression containing protein crh reveals an unexpected swapping domain as an untertwinned dimer
PDB Compounds: (A:) HPr-like protein crh

SCOPe Domain Sequences for d1mo1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mo1a1 d.94.1.1 (A:1-85) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]}
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeev

SCOPe Domain Coordinates for d1mo1a1:

Click to download the PDB-style file with coordinates for d1mo1a1.
(The format of our PDB-style files is described here.)

Timeline for d1mo1a1: