Lineage for d1mnfn1 (1mnf N:2-136,N:410-526)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011121Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 2011122Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 2011123Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 2011124Protein GroEL, E domain [48594] (4 species)
  7. 2011125Species Escherichia coli [TaxId:562] [48595] (11 PDB entries)
  8. 2011174Domain d1mnfn1: 1mnf N:2-136,N:410-526 [91360]
    Other proteins in same PDB: d1mnfa2, d1mnfa3, d1mnfb2, d1mnfb3, d1mnfc2, d1mnfc3, d1mnfd2, d1mnfd3, d1mnfe2, d1mnfe3, d1mnff2, d1mnff3, d1mnfg2, d1mnfg3, d1mnfh2, d1mnfh3, d1mnfi2, d1mnfi3, d1mnfj2, d1mnfj3, d1mnfk2, d1mnfk3, d1mnfl2, d1mnfl3, d1mnfm2, d1mnfm3, d1mnfn2, d1mnfn3

Details for d1mnfn1

PDB Entry: 1mnf (more details), 3 Å

PDB Description: Domain motions in GroEL upon binding of an oligopeptide
PDB Compounds: (N:) groEL protein

SCOPe Domain Sequences for d1mnfn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnfn1 a.129.1.1 (N:2-136,N:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlpk

SCOPe Domain Coordinates for d1mnfn1:

Click to download the PDB-style file with coordinates for d1mnfn1.
(The format of our PDB-style files is described here.)

Timeline for d1mnfn1: