SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1mnfl3 (1mnf L:137-190,L:367-409)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172066Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 2172067Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 2172068Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 2172069Protein GroEL, I domain [54851] (4 species)
  7. 2172070Species Escherichia coli [TaxId:562] [54852] (11 PDB entries)
  8. 2172117Domain d1mnfl3: 1mnf L:137-190,L:367-409 [91356]
    Other proteins in same PDB: d1mnfa1, d1mnfa2, d1mnfb1, d1mnfb2, d1mnfc1, d1mnfc2, d1mnfd1, d1mnfd2, d1mnfe1, d1mnfe2, d1mnff1, d1mnff2, d1mnfg1, d1mnfg2, d1mnfh1, d1mnfh2, d1mnfi1, d1mnfi2, d1mnfj1, d1mnfj2, d1mnfk1, d1mnfk2, d1mnfl1, d1mnfl2, d1mnfm1, d1mnfm2, d1mnfn1, d1mnfn2

Details for d1mnfl3

PDB Entry: 1mnf (more details), 3 Å

PDB Description: Domain motions in GroEL upon binding of an oligopeptide
PDB Compounds: (L:) groEL protein

SCOPe Domain Sequences for d1mnfl3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnfl3 d.56.1.1 (L:137-190,L:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOPe Domain Coordinates for d1mnfl3:

Click to download the PDB-style file with coordinates for d1mnfl3.
(The format of our PDB-style files is described here.)

Timeline for d1mnfl3: