Lineage for d1mmib1 (1mmi B:1-122)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511273Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 511274Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 511275Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. 511276Protein DNA polymerase III, beta subunit [55981] (1 species)
  7. 511277Species Escherichia coli [TaxId:562] [55982] (6 PDB entries)
  8. 511287Domain d1mmib1: 1mmi B:1-122 [91312]

Details for d1mmib1

PDB Entry: 1mmi (more details), 1.85 Å

PDB Description: e. coli dna polymerase beta subunit

SCOP Domain Sequences for d1mmib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmib1 d.131.1.1 (B:1-122) DNA polymerase III, beta subunit {Escherichia coli}
mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
dw

SCOP Domain Coordinates for d1mmib1:

Click to download the PDB-style file with coordinates for d1mmib1.
(The format of our PDB-style files is described here.)

Timeline for d1mmib1: