SCOP 1.73: Domain d1mjul2: 1mju L:108-214

Lineage for d1mjul2 (1mju L:108-214)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d1mjul2: 1mju L:108-214 [91305]
   Other proteins in same PDB: d1mjuh1, d1mjuh2, d1mjul1
   part of the esterolytic Fab ms6-164
   complexed with gol

Details for d1mjul2

PDB Entry: 1mju, 1.22 Å

PDB Description: 1.22 angstrom resolution crystal structure of the fab fragment of esterolytic antibody ms6-12

PDB Compounds: (L:) immunoglobulin ms6-12

SCOP Domain Sequences for d1mjul2:

Sequence; same for both SEQRES and ATOM records:

>d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1mjul2:

• d1mjul2 first appeared in SCOP 1.67
  
• d1mjul2 appears in SCOP 1.71
  
• d1mjul2 appears in SCOP 1.75
  
• d1mjul2 appears in the current release, SCOPe 2.08