Lineage for d1mjjl2 (1mjj L:108-211)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656177Domain d1mjjl2: 1mjj L:108-211 [91301]
    Other proteins in same PDB: d1mjja1, d1mjjb1, d1mjjb2, d1mjjh1, d1mjjh2, d1mjjl1
    part of the esterolytic Fab ms6-164
    complexed with hal, so4

Details for d1mjjl2

PDB Entry: 1mjj (more details), 2.1 Å

PDB Description: high resolution crystal structure of the complex of the fab fragment of esterolytic antibody ms6-12 and a transition-state analog
PDB Compounds: (L:) immunoglobulin ms6-12

SCOP Domain Sequences for d1mjjl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjjl2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1mjjl2:

Click to download the PDB-style file with coordinates for d1mjjl2.
(The format of our PDB-style files is described here.)

Timeline for d1mjjl2: