Lineage for d1mjjh1 (1mjj H:1-113)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652563Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 652593Domain d1mjjh1: 1mjj H:1-113 [91298]
    Other proteins in same PDB: d1mjja1, d1mjja2, d1mjjb2, d1mjjh2, d1mjjl1, d1mjjl2
    part of the esterolytic Fab ms6-164
    complexed with hal, so4

Details for d1mjjh1

PDB Entry: 1mjj (more details), 2.1 Å

PDB Description: high resolution crystal structure of the complex of the fab fragment of esterolytic antibody ms6-12 and a transition-state analog
PDB Compounds: (H:) immunoglobulin ms6-12

SCOP Domain Sequences for d1mjjh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjjh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqqpgaelvkpgasvklsckasgytftnywinwvkqrpgqglewigniypgssythy
nekfknkatltvdtssstaymqlssltsddsavyycanklgwfpywgqgtlvtvsa

SCOP Domain Coordinates for d1mjjh1:

Click to download the PDB-style file with coordinates for d1mjjh1.
(The format of our PDB-style files is described here.)

Timeline for d1mjjh1: