Lineage for d1mj7l1 (1mj7 L:1-107)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451743Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)
  8. 451807Domain d1mj7l1: 1mj7 L:1-107 [91288]
    Other proteins in same PDB: d1mj7h1, d1mj7h2, d1mj7l2
    part of the esterolytic Fab ms6-164

Details for d1mj7l1

PDB Entry: 1mj7 (more details), 2.25 Å

PDB Description: Crystal Structure Of The Complex Of The Fab fragment of Esterolytic Antibody MS5-393 and A Transition-State Analog

SCOP Domain Sequences for d1mj7l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mj7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
eivmtqaapsvpvtpgesvsiscrssksllhsngntylnwflqrpgqspqlliyrmsnla
sgvpdrfsgsgsetaftlrtsrveaedvgvyycmqhleypftfgsgtklelk

SCOP Domain Coordinates for d1mj7l1:

Click to download the PDB-style file with coordinates for d1mj7l1.
(The format of our PDB-style files is described here.)

Timeline for d1mj7l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mj7l2