SCOP 1.71: Domain d1miel2: 1mie L:108-213

Lineage for d1miel2 (1mie L:108-213)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)

8. Domain d1miel2: 1mie L:108-213 [91284]
   Other proteins in same PDB: d1mieh1, d1mieh2, d1miel1
   part of the esterolytic Fab ms6-164

Details for d1miel2

PDB Entry: 1mie, 1.95 Å

PDB Description: Crystal Structure Of The Fab Fragment of Esterolytic Antibody MS5-393

SCOP Domain Sequences for d1miel2:

Sequence; same for both SEQRES and ATOM records:

>d1miel2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1miel2:

• d1miel2 first appeared in SCOP 1.67
  
• d1miel2 appears in SCOP 1.69
  
• d1miel2 appears in SCOP 1.73
  
• d1miel2 appears in the current release, SCOPe 2.08