Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (141 PDB entries) |
Domain d1mieh1: 1mie H:5-113 [91281] Other proteins in same PDB: d1mieh2, d1miel1, d1miel2 part of the esterolytic Fab ms6-164 |
PDB Entry: 1mie (more details), 1.95 Å
SCOP Domain Sequences for d1mieh1:
Sequence, based on SEQRES records: (download)
>d1mieh1 b.1.1.1 (H:5-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2} qqpgaelvkpgasvklsckasgytftsswinwvkqrpgqglewignvypgssstnynekf knkatltvdtssstaymqlssltsddsafyycvrkdyswfpywgqgtlvtvsa
>d1mieh1 b.1.1.1 (H:5-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2} qqpgaelvkpgasvklscwinwvkqrpgqglewignvypgssstnynekfknkatltvdt ssstaymqlssltsddsafyycvrpywgqgtlvtvsa
Timeline for d1mieh1: