Lineage for d1mida_ (1mid A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356526Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 356527Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (3 families) (S)
    can be classified as disulfide-rich
  5. 356528Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (3 proteins)
  6. 356534Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)
  7. 356535Species Barley (Hordeum vulgare) [TaxId:4513] [47705] (4 PDB entries)
  8. 356536Domain d1mida_: 1mid A: [91280]
    complexed with lap

Details for d1mida_

PDB Entry: 1mid (more details), 1.71 Å

PDB Description: Non-specific lipid transfer protein 1 from barley in complex with L-alfa-lysophosphatidylcholine, Laudoyl

SCOP Domain Sequences for d1mida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mida_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Barley (Hordeum vulgare)}
lncgqvdskmkpcltyvqggpgpsgeccngvrdlhnqaqssgdrqtvcnclkgiargihn
lnlnnaasipskcnvnvpytispdidcsriy

SCOP Domain Coordinates for d1mida_:

Click to download the PDB-style file with coordinates for d1mida_.
(The format of our PDB-style files is described here.)

Timeline for d1mida_: