Lineage for d1mi8a_ (1mi8 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073129Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 2073130Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families) (S)
    duplication: contains two intertwined structural repeats
  5. 2073135Family b.86.1.2: Intein (protein splicing domain) [51298] (5 protein domains)
  6. 2073136Protein DnaB intein [102011] (1 species)
    miniintein lacking the homing endonuclease domain
  7. 2073137Species Synechocystis sp. PCC 6803 [TaxId:1148] [102012] (1 PDB entry)
  8. 2073138Domain d1mi8a_: 1mi8 A: [91279]

Details for d1mi8a_

PDB Entry: 1mi8 (more details), 2 Å

PDB Description: 2.0 angstrom crystal structure of a dnab intein from synechocystis sp. pcc 6803
PDB Compounds: (A:) DnaB intein

SCOPe Domain Sequences for d1mi8a_:

Sequence, based on SEQRES records: (download)

>d1mi8a_ b.86.1.2 (A:) DnaB intein {Synechocystis sp. PCC 6803 [TaxId: 1148]}
sgaisgdslislastgkrvsikdlldekdfeiwaineqtmklesakvsrvfmtgkklvyi
lktrlgrtikatanhrfltidgwkrldelslkehialprklessslqlspeieklsqsdi
swdsivsitetgveevfdltvpgphnfvandiivhasi

Sequence, based on observed residues (ATOM records): (download)

>d1mi8a_ b.86.1.2 (A:) DnaB intein {Synechocystis sp. PCC 6803 [TaxId: 1148]}
sgaisgdslislastgkrvsikdlldekdfeiwaineqtmklesakvsrvfmtgkklvyi
lktrlgrtikatanhrfltidgwkrldelslkehialprksdiswdsivsitetgveevf
dltvpgphnfvandiivhasi

SCOPe Domain Coordinates for d1mi8a_:

Click to download the PDB-style file with coordinates for d1mi8a_.
(The format of our PDB-style files is described here.)

Timeline for d1mi8a_: