SCOP 1.67: Domain d1mi3c_: 1mi3 C:

Lineage for d1mi3c_ (1mi3 C:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (14 proteins)
   Common fold covers whole protein structure

6. Protein Xylose reductase [75058] (1 species)

7. Species Fungi (Candida tenuis) [TaxId:45596] [75059] (3 PDB entries)

8. Domain d1mi3c_: 1mi3 C: [91276]

Details for d1mi3c_

PDB Entry: 1mi3, 1.8 Å

PDB Description: 1.8 Angstrom structure of xylose reductase from Candida tenuis in complex with NAD

SCOP Domain Sequences for d1mi3c_:

Sequence; same for both SEQRES and ATOM records:

>d1mi3c_ c.1.7.1 (C:) Xylose reductase {Fungi (Candida tenuis)}
sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
diglrfndpwdwdnipifv

Timeline for d1mi3c_:

• d1mi3c_ is new in SCOP 1.67
  
• d1mi3c_ appears in SCOP 1.69
  
• d1mi3c_ appears in the current release, SCOPe 2.08