Lineage for d1mi3c_ (1mi3 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2081223Protein Xylose reductase [75058] (1 species)
  7. 2081224Species Fungus (Candida tenuis) [TaxId:45596] [75059] (8 PDB entries)
    Uniprot O74237
  8. 2081227Domain d1mi3c_: 1mi3 C: [91276]
    complexed with nad

Details for d1mi3c_

PDB Entry: 1mi3 (more details), 1.8 Å

PDB Description: 1.8 Angstrom structure of xylose reductase from Candida tenuis in complex with NAD
PDB Compounds: (C:) xylose reductase

SCOPe Domain Sequences for d1mi3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi3c_ c.1.7.1 (C:) Xylose reductase {Fungus (Candida tenuis) [TaxId: 45596]}
sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
diglrfndpwdwdnipifv

SCOPe Domain Coordinates for d1mi3c_:

Click to download the PDB-style file with coordinates for d1mi3c_.
(The format of our PDB-style files is described here.)

Timeline for d1mi3c_: