Lineage for d1mi3a_ (1mi3 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473932Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 473933Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
    Common fold covers whole protein structure
  6. 474040Protein Xylose reductase [75058] (1 species)
  7. 474041Species Fungi (Candida tenuis) [TaxId:45596] [75059] (3 PDB entries)
  8. 474044Domain d1mi3a_: 1mi3 A: [91274]

Details for d1mi3a_

PDB Entry: 1mi3 (more details), 1.8 Å

PDB Description: 1.8 Angstrom structure of xylose reductase from Candida tenuis in complex with NAD

SCOP Domain Sequences for d1mi3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis)}
sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
diglrfndpwdwdnipifv

SCOP Domain Coordinates for d1mi3a_:

Click to download the PDB-style file with coordinates for d1mi3a_.
(The format of our PDB-style files is described here.)

Timeline for d1mi3a_: