Lineage for d1mh5h2 (1mh5 H:114-214)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365143Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
  8. 365262Domain d1mh5h2: 1mh5 H:114-214 [91271]
    Other proteins in same PDB: d1mh5a1, d1mh5a2, d1mh5b1, d1mh5h1, d1mh5l1, d1mh5l2
    part of the esterolytic Fab ms6-164
    complexed with hal, so4

Details for d1mh5h2

PDB Entry: 1mh5 (more details), 2.1 Å

PDB Description: The Structure Of The Complex Of The Fab Fragment Of The Esterolytic Antibody MS6-164 and A Transition-State Analog

SCOP Domain Sequences for d1mh5h2:

Sequence, based on SEQRES records: (download)

>d1mh5h2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdtsgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpa

Sequence, based on observed residues (ATOM records): (download)

>d1mh5h2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
vtvitcnvahpa

SCOP Domain Coordinates for d1mh5h2:

Click to download the PDB-style file with coordinates for d1mh5h2.
(The format of our PDB-style files is described here.)

Timeline for d1mh5h2: