Lineage for d1mh5h1 (1mh5 H:2-113)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363037Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (141 PDB entries)
  8. 363092Domain d1mh5h1: 1mh5 H:2-113 [91270]
    Other proteins in same PDB: d1mh5a1, d1mh5a2, d1mh5b2, d1mh5h2, d1mh5l1, d1mh5l2
    part of the esterolytic Fab ms6-164
    complexed with hal, so4

Details for d1mh5h1

PDB Entry: 1mh5 (more details), 2.1 Å

PDB Description: The Structure Of The Complex Of The Fab Fragment Of The Esterolytic Antibody MS6-164 and A Transition-State Analog

SCOP Domain Sequences for d1mh5h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mh5h1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
vqlqqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewigniypdsyrtnyn
ekfkrkatltvdtssstaymqlssltsddsavyycvrkhysydgvvywgqgtlvtvsa

SCOP Domain Coordinates for d1mh5h1:

Click to download the PDB-style file with coordinates for d1mh5h1.
(The format of our PDB-style files is described here.)

Timeline for d1mh5h1: