Lineage for d1mh5b1 (1mh5 B:2-113)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2022086Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 2022150Domain d1mh5b1: 1mh5 B:2-113 [91268]
    Other proteins in same PDB: d1mh5a1, d1mh5a2, d1mh5b2, d1mh5h2, d1mh5l1, d1mh5l2
    part of the esterolytic Fab ms6-164
    complexed with hal, so4

Details for d1mh5b1

PDB Entry: 1mh5 (more details), 2.1 Å

PDB Description: The Structure Of The Complex Of The Fab Fragment Of The Esterolytic Antibody MS6-164 and A Transition-State Analog
PDB Compounds: (B:) immunoglobulin ms6-164

SCOPe Domain Sequences for d1mh5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mh5b1 b.1.1.1 (B:2-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
vqlqqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewigniypdsyrtnyn
ekfkrkatltvdtssstaymqlssltsddsavyycvrkhysydgvvywgqgtlvtvsa

SCOPe Domain Coordinates for d1mh5b1:

Click to download the PDB-style file with coordinates for d1mh5b1.
(The format of our PDB-style files is described here.)

Timeline for d1mh5b1: