Lineage for d1mf4a_ (1mf4 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015739Protein Snake phospholipase A2 [48624] (38 species)
  7. 2015755Species Andaman cobra (Naja sagittifera), isoform 4 [TaxId:195058] [89171] (14 PDB entries)
    Uniprot P60045 8-126 # ! yet another isoform, 98% identity
  8. 2015763Domain d1mf4a_: 1mf4 A: [91261]
    complexed with a designed peptide inhibitor
    complexed with ca

Details for d1mf4a_

PDB Entry: 1mf4 (more details), 1.9 Å

PDB Description: Structure-based design of potent and selective inhibitors of phospholipase A2: Crystal structure of the complex formed between phosholipase A2 from Naja Naja sagittifera and a designed peptide inhibitor at 1.9 A resolution
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1mf4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mf4a_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 4 [TaxId: 195058]}
nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn

SCOPe Domain Coordinates for d1mf4a_:

Click to download the PDB-style file with coordinates for d1mf4a_.
(The format of our PDB-style files is described here.)

Timeline for d1mf4a_: