SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1mepc_ (1mep C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2063610Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2063611Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2063612Family b.61.1.1: Avidin/streptavidin [50877] (3 protein domains)
  6. 2063637Protein Streptavidin [50878] (1 species)
  7. 2063638Species Streptomyces avidinii [TaxId:1895] [50879] (124 PDB entries)
  8. 2063772Domain d1mepc_: 1mep C: [91254]
    complexed with btn; mutant

Details for d1mepc_

PDB Entry: 1mep (more details), 1.65 Å

PDB Description: Crystal Structure of Streptavidin Double Mutant S45A/D128A with Biotin: Cooperative Hydrogen-Bond Interactions in the Streptavidin-Biotin System.
PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d1mepc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mepc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghatftkv

SCOPe Domain Coordinates for d1mepc_:

Click to download the PDB-style file with coordinates for d1mepc_.
(The format of our PDB-style files is described here.)

Timeline for d1mepc_: