Lineage for d1me6b_ (1me6 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377363Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 377364Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 377776Family b.50.1.2: Pepsin-like [50646] (9 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 377937Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 377938Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (8 PDB entries)
  8. 377952Domain d1me6b_: 1me6 B: [91248]
    complexed with ivs

Details for d1me6b_

PDB Entry: 1me6 (more details), 2.7 Å

PDB Description: crystal structure of plasmepsin ii, an aspartyl protease from plasmodium falciparum, in complex with a statine-based inhibitor

SCOP Domain Sequences for d1me6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1me6b_ b.50.1.2 (B:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

SCOP Domain Coordinates for d1me6b_:

Click to download the PDB-style file with coordinates for d1me6b_.
(The format of our PDB-style files is described here.)

Timeline for d1me6b_: