![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
![]() | Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species) |
![]() | Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (18 PDB entries) |
![]() | Domain d1me6a_: 1me6 A: [91247] complexed with ivs |
PDB Entry: 1me6 (more details), 2.7 Å
SCOPe Domain Sequences for d1me6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1me6a_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi lgdpfmrkyftvfdydnhsvgialakknl
Timeline for d1me6a_: