SCOP 1.67: Domain d1me6a_: 1me6 A:

Lineage for d1me6a_ (1me6 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (9 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)

7. Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (8 PDB entries)

8. Domain d1me6a_: 1me6 A: [91247]

Details for d1me6a_

PDB Entry: 1me6, 2.7 Å

PDB Description: crystal structure of plasmepsin ii, an aspartyl protease from plasmodium falciparum, in complex with a statine-based inhibitor

SCOP Domain Sequences for d1me6a_:

Sequence; same for both SEQRES and ATOM records:

>d1me6a_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

Timeline for d1me6a_:

• d1me6a_ is new in SCOP 1.67
  
• d1me6a_ appears in SCOP 1.69
  
• d1me6a_ appears in the current release, SCOPe 2.08