Lineage for d1md8a1 (1md8 A:434-686)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. Protein Complement C1R protease, catalytic domain [74976] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [74977] (3 PDB entries)
  8. 2056268Domain d1md8a1: 1md8 A:434-686 [91245]
    Other proteins in same PDB: d1md8a2

Details for d1md8a1

PDB Entry: 1md8 (more details), 2.8 Å

PDB Description: Monomeric structure of the active catalytic domain of complement protease C1r
PDB Compounds: (A:) c1r complement serine protease

SCOPe Domain Sequences for d1md8a1:

Sequence, based on SEQRES records: (download)

>d1md8a1 b.47.1.2 (A:434-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
cgkpvnpveqrqriiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkehe
aqsnasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlg
pnllpiclpdndtfydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrm
dvfsqnmfcaghpslkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkv
lnyvdwikkemee

Sequence, based on observed residues (ATOM records): (download)

>d1md8a1 b.47.1.2 (A:434-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
cgkpvnpveqriiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkehasl
dvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpic
lpdndtfydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnm
fcaghpslkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwi
kkemee

SCOPe Domain Coordinates for d1md8a1:

Click to download the PDB-style file with coordinates for d1md8a1.
(The format of our PDB-style files is described here.)

Timeline for d1md8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1md8a2