SCOPe 2.01: Domain d1md7a2: 1md7 A:358-433

Lineage for d1md7a2 (1md7 A:358-433)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement C1R protease domains [75682] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75683] (4 PDB entries)

8. Domain d1md7a2: 1md7 A:358-433 [91244]
   Other proteins in same PDB: d1md7a1
   complexed with ndg

Details for d1md7a2

PDB Entry: 1md7, 3.2 Å

PDB Description: monomeric structure of the zymogen of complement protease c1r

PDB Compounds: (A:) c1r complement serine protease

SCOPe Domain Sequences for d1md7a2:

Sequence, based on SEQRES records:

>d1md7a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}
dcgqprnlpngdfrytttmgvntykariqyychepyykmqtragsreseqgvytctaqgi
wkneqkgekiprclpv

Sequence, based on observed residues (ATOM records):

>d1md7a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}
dcgqprnlpngdfrytttmgvntykariqyychepyykmqtqgvytctaqgiwkneqkge
kiprclpv

Timeline for d1md7a2:

• d1md7a2 first appeared in SCOP 1.67
  
• d1md7a2 appears in SCOP 1.75
  
• d1md7a2 appears in SCOPe 2.02
  
• d1md7a2 appears in the current release, SCOPe 2.08