Lineage for d1md6a_ (1md6 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061458Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2061773Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 2061833Protein Interleukin-1F5 [101780] (1 species)
  7. 2061834Species Mouse (Mus musculus) [TaxId:10090] [101781] (1 PDB entry)
  8. 2061835Domain d1md6a_: 1md6 A: [91242]

Details for d1md6a_

PDB Entry: 1md6 (more details), 1.6 Å

PDB Description: High resolution crystal structure of murine IL-1F5 reveals unique loop conformation for specificity
PDB Compounds: (A:) interleukin 1 family, member 5 (delta)

SCOPe Domain Sequences for d1md6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1md6a_ b.42.1.2 (A:) Interleukin-1F5 {Mouse (Mus musculus) [TaxId: 10090]}
vlsgalcfrmkdsalkvlylhnnqllagglhaekvikgeeisvvpnraldaslspvilgv
qggsqclscgtekgpilklepvnimelylgakesksftfyrrdmgltssfesaaypgwfl
ctspeadqpvrltqipedpawdapitdfyfqqcd

SCOPe Domain Coordinates for d1md6a_:

Click to download the PDB-style file with coordinates for d1md6a_.
(The format of our PDB-style files is described here.)

Timeline for d1md6a_: