Lineage for d1md6a_ (1md6 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375317Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 375318Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 375446Family b.42.1.2: Interleukin-1 (IL-1) [50362] (5 proteins)
  6. 375483Protein Interleukin-1F5 [101780] (1 species)
  7. 375484Species Mouse (Mus musculus) [TaxId:10090] [101781] (1 PDB entry)
  8. 375485Domain d1md6a_: 1md6 A: [91242]

Details for d1md6a_

PDB Entry: 1md6 (more details), 1.6 Å

PDB Description: High resolution crystal structure of murine IL-1F5 reveals unique loop conformation for specificity

SCOP Domain Sequences for d1md6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1md6a_ b.42.1.2 (A:) Interleukin-1F5 {Mouse (Mus musculus)}
vlsgalcfrmkdsalkvlylhnnqllagglhaekvikgeeisvvpnraldaslspvilgv
qggsqclscgtekgpilklepvnimelylgakesksftfyrrdmgltssfesaaypgwfl
ctspeadqpvrltqipedpawdapitdfyfqqcd

SCOP Domain Coordinates for d1md6a_:

Click to download the PDB-style file with coordinates for d1md6a_.
(The format of our PDB-style files is described here.)

Timeline for d1md6a_: