Lineage for d1m9ha_ (1m9h A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473932Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 473933Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
    Common fold covers whole protein structure
  6. 473934Protein 2,5-diketo-D-gluconic acid reductase A [51443] (2 species)
  7. 473935Species Corynebacterium sp. [TaxId:1720] [51444] (3 PDB entries)
  8. 473938Domain d1m9ha_: 1m9h A: [91236]

Details for d1m9ha_

PDB Entry: 1m9h (more details), 2 Å

PDB Description: corynebacterium 2,5-dkgr a and phe 22 replaced with tyr (f22y), lys 232 replaced with gly (k232g), arg 238 replaced with his (r238h)and ala 272 replaced with gly (a272g)in presence of nadh cofactor

SCOP Domain Sequences for d1m9ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9ha_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp.}
tvpsivlndgnsipqlgygvykvppadtqraveealevgyrhidtaaiygneegvgaaia
asgiarddlfittklwndrhdgdepaaaiaeslaklaldqvdlylvhwptpaadnyvhaw
ekmielraagltrsigvsnhlvphlerivaatgvvpavnqielhpayqqreitdwaaahd
vkieswgplgqgkydlfgaepvtaaaaahgktpaqavlrwhlqkgfvvfpgsvrrehlee
nldvfdfdltdteiaaidamdpgdgsgrvsghpdevd

SCOP Domain Coordinates for d1m9ha_:

Click to download the PDB-style file with coordinates for d1m9ha_.
(The format of our PDB-style files is described here.)

Timeline for d1m9ha_: