Lineage for d1m93.1 (1m93 A:,B:,C:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568346Protein Viral serpin crmA (cytokine response modifier protein) [56593] (1 species)
  7. 2568347Species Cowpox virus [TaxId:10243] [56594] (3 PDB entries)
  8. 2568348Domain d1m93.1: 1m93 A:,B:,C: [91235]
    cleaved form
    complexed with po4

Details for d1m93.1

PDB Entry: 1m93 (more details), 1.65 Å

PDB Description: 1.65 a structure of cleaved viral serpin crma
PDB Compounds: (A:) Serine proteinase inhibitor 2, (B:) Serine proteinase inhibitor 2, (C:) Serine proteinase inhibitor 2

SCOPe Domain Sequences for d1m93.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1m93.1 e.1.1.1 (A:,B:,C:) Viral serpin crmA (cytokine response modifier protein) {Cowpox virus [TaxId: 10243]}
mdifreiassmkgenvfisppsissvltilyygangstaeqlskyvXdisfksmnkvygr
ysavfkdsflrkigdnfqtvdftdsrtvdainksvdiftegkinplldeplspdtsllai
savyfkakwlmpfekeftsdypfyvsptemvdvsmmsmygeafnhasvkesfgnfsiiel
pyvgdtsmvvilpdnidglesieqnltdtnfkkwsdsmdamfidvhipkfkvtgsynlvd
alvklgltevfgstgdysnmsnsdvsvdamihktyidvneeyteaaaatsalXtnefsad
hpfiyvirhvdgkilfvgrysspt

SCOPe Domain Coordinates for d1m93.1:

Click to download the PDB-style file with coordinates for d1m93.1.
(The format of our PDB-style files is described here.)

Timeline for d1m93.1: