SCOP 1.71: Domain d1m8te_: 1m8t E:

Lineage for d1m8te_ (1m8t E:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species King cobra (Ophiophagus hannah), an acidic isoform [TaxId:8665] [101482] (1 PDB entry)

8. Domain d1m8te_: 1m8t E: [91231]

Details for d1m8te_

PDB Entry: 1m8t, 2.1 Å

PDB Description: Structure of an acidic Phospholipase A2 from the venom of Ophiophagus hannah at 2.1 resolution from a hemihedrally twinned crystal form

SCOP Domain Sequences for d1m8te_:

Sequence; same for both SEQRES and ATOM records:

>d1m8te_ a.133.1.2 (E:) Snake phospholipase A2 {King cobra (Ophiophagus hannah), an acidic isoform}
hlvqfngmirctipgsipwwdysdygcycgsggsgtpvdeldrccqvhdncytqaqqlte
cspyskrysydcsegtltckadndecaafvcdcdrvaaicfagapynkeninidtttrc

Timeline for d1m8te_:

• d1m8te_ first appeared in SCOP 1.67
  
• d1m8te_ appears in SCOP 1.69
  
• d1m8te_ appears in SCOP 1.73
  
• d1m8te_ appears in the current release, SCOPe 2.08