SCOPe 2.05: Domain d1m8tc_: 1m8t C:

Lineage for d1m8tc_ (1m8t C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (36 species)

7. Species King cobra (Ophiophagus hannah), an acidic isoform [TaxId:8665] [101482] (1 PDB entry)

8. Domain d1m8tc_: 1m8t C: [91229]
   complexed with ca, hez

Details for d1m8tc_

PDB Entry: 1m8t, 2.1 Å

PDB Description: Structure of an acidic Phospholipase A2 from the venom of Ophiophagus hannah at 2.1 resolution from a hemihedrally twinned crystal form

PDB Compounds: (C:) phospholipase a2

SCOPe Domain Sequences for d1m8tc_:

Sequence; same for both SEQRES and ATOM records:

>d1m8tc_ a.133.1.2 (C:) Snake phospholipase A2 {King cobra (Ophiophagus hannah), an acidic isoform [TaxId: 8665]}
hlvqfngmirctipgsipwwdysdygcycgsggsgtpvdeldrccqvhdncytqaqqlte
cspyskrysydcsegtltckadndecaafvcdcdrvaaicfagapynkeninidtttrc

Timeline for d1m8tc_:

• d1m8tc_ first appeared in SCOP 1.67
  
• d1m8tc_ appears in SCOPe 2.04
  
• d1m8tc_ appears in SCOPe 2.06
  
• d1m8tc_ appears in the current release, SCOPe 2.08