Lineage for d1m8ta_ (1m8t A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750246Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1750247Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1750252Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1750360Protein Snake phospholipase A2 [48624] (36 species)
  7. 1750487Species King cobra (Ophiophagus hannah), an acidic isoform [TaxId:8665] [101482] (1 PDB entry)
  8. 1750488Domain d1m8ta_: 1m8t A: [91227]
    complexed with ca, hez

Details for d1m8ta_

PDB Entry: 1m8t (more details), 2.1 Å

PDB Description: Structure of an acidic Phospholipase A2 from the venom of Ophiophagus hannah at 2.1 resolution from a hemihedrally twinned crystal form
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1m8ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8ta_ a.133.1.2 (A:) Snake phospholipase A2 {King cobra (Ophiophagus hannah), an acidic isoform [TaxId: 8665]}
hlvqfngmirctipgsipwwdysdygcycgsggsgtpvdeldrccqvhdncytqaqqlte
cspyskrysydcsegtltckadndecaafvcdcdrvaaicfagapynkeninidtttrc

SCOPe Domain Coordinates for d1m8ta_:

Click to download the PDB-style file with coordinates for d1m8ta_.
(The format of our PDB-style files is described here.)

Timeline for d1m8ta_: